PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ONIVA03G40780.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family Dof
Protein Properties Length: 411aa    MW: 40799.1 Da    PI: 9.248
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ONIVA03G40780.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof122.91.1e-38111171262
           zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                      +e  lkcprC+stntkfCy+nnyslsqPr+fCk+CrryWt+GGalrnvPvGgg+r+nk+++
  ONIVA03G40780.1 111 PEPGLKCPRCESTNTKFCYFNNYSLSQPRHFCKTCRRYWTRGGALRNVPVGGGCRRNKRTK 171
                      56789*****************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-3798169IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.609115169IPR003851Zinc finger, Dof-type
PfamPF027012.8E-32115169IPR003851Zinc finger, Dof-type
PROSITE patternPS013610117153IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 411 aa     Download sequence    Send to blast
MVFSSVPAVY LDPPNWNQQQ QQAHHGQLPS GGNGGGGGGG GGGVDAHHHH HHQLPPMPPH  60
HGGLMAPRPD MVAAAVAASG GGGGGGGPTG GTAVRPGSMT ERARLAKIPQ PEPGLKCPRC  120
ESTNTKFCYF NNYSLSQPRH FCKTCRRYWT RGGALRNVPV GGGCRRNKRT KSSKSSSSTS  180
AAGSASATGG TSSSTSSTAT GGSSSAAAAA AMMPPQAQLP FLASLHHPLG GGDHYSSGAS  240
RLGFPGLSSL DPVDYQLGGG AAAAAAIGLE QWRLPQIQQL PFLSRNDAMP PPMSGIYPFD  300
AEAAADAAGF AGQLLAGTKV PGSSGLITQL ASVKMEDSNA QSAAMNSSPR EFLGLPGNLQ  360
FWGGGNGAGP GGNGDGATGG SGAGVAPGGG GSGGGWADLS GFNSSSSGNI L
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00483DAPTransfer from AT5G02460Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126110.0CP012611.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 3 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015628807.11e-172PREDICTED: dof zinc finger protein DOF2.4 isoform X2
TrEMBLA0A0E0GVP10.0A0A0E0GVP1_ORYNI; Uncharacterized protein
STRINGBGIOSGA013837-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP48932961
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37590.11e-40DNA binding with one finger 2.4